PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g38560.1.p
Common NameBRADI_2g38560, LOC100843053
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 327aa    MW: 36287.4 Da    PI: 5.2756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g38560.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding67.62.1e-214289148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd llvd+v+q+G g+W++ ar+ g++Rt+k+c++rw++yl
  Bradi2g38560.1.p 42 RGPWTAEEDALLVDYVAQHGEGRWNSLARCAGLRRTGKSCRLRWLNYL 89
                      89********************************************97 PP

2Myb_DNA-binding52.21.4e-1695138146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T+eE++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Bradi2g38560.1.p  95 RGNITAEEQLLILDLHSRWGNR-WSKIAQRLP-GRTDNEIKNYWRT 138
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6413793IPR017930Myb domain
SuperFamilySSF466891.8E-3140136IPR009057Homeodomain-like
SMARTSM007174.4E-174191IPR001005SANT/Myb domain
PfamPF002492.2E-184289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-254396IPR009057Homeodomain-like
CDDcd001671.14E-134489No hitNo description
PROSITE profilePS5129418.45894144IPR017930Myb domain
SMARTSM007171.6E-1494142IPR001005SANT/Myb domain
PfamPF002496.6E-1595138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2397142IPR009057Homeodomain-like
CDDcd001672.30E-1199138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDMDKEYYMG MEAAMSPGGS SEPAKAVAVA ATASEDEGDL RRGPWTAEED ALLVDYVAQH  60
GEGRWNSLAR CAGLRRTGKS CRLRWLNYLR PDVRRGNITA EEQLLILDLH SRWGNRWSKI  120
AQRLPGRTDN EIKNYWRTRV QKHARQLRCD VNSRQFRDVV RLVWMPRLIE RMHADANNAG  180
VPPAPETMTT TMATRADHRH GMSRSEPMIG RAADATAEMS PDDTSSTLRS SVLTAEMVST  240
MHEGQYRLSP WGAASAVTTN NADGTAVNCF VRRDEGAMGG DDHAIHGGDD ELGGSWSELL  300
AATGLPEFEF GDFDDNLWSL EDIYAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-253913624120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569075.10.0PREDICTED: protein ODORANT1
TrEMBLI1HMR90.0I1HMR9_BRADI; Uncharacterized protein
STRINGBRADI2G38560.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.15e-78myb domain protein 108